DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Stk32a

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_848864.1 Gene:Stk32a / 269019 MGIID:2442403 Length:398 Species:Mus musculus


Alignment Length:322 Identity:94/322 - (29%)
Similarity:169/322 - (52%) Gaps:39/322 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   822 GSGAQQPSP--QEND------FDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVE 878
            |:.....:|  .||:      |:|::.|..|::|.|.:|:...|::.:|||.:||...:.||:|.
Mouse     2 GANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDTKKMYAMKYMNKQKCVERNEVR 66

  Fly   879 QVFAERDILSFADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETV 943
            .||.|..|:...::||:|:::.||:.::.:.:|::.:.|||....|:.......|..:.:..|..
Mouse    67 NVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQEDTVKLFICELA 131

  Fly   944 LAVEYLHSYGIVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQV 1008
            :|::||.|..|:|||:||||:|:...||:.:|||.::.|             :..|||..:   |
Mouse   132 MALDYLQSQRIIHRDMKPDNILLDEHGHVHITDFNIAAM-------------LPKETRITT---V 180

  Fly  1009 YGTPEYIAPEVILRQ---GYGKPVDWWSMGIILYEFLIGCVPFF---GETTEELFAHTVNDDIEW 1067
            .||..|:|||:...:   ||...|||||:|:..||.|.|..|:.   ..:::|:........:.:
Mouse   181 AGTKPYMAPEMFTSRKETGYSFAVDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVNMFETAIVTY 245

  Fly  1068 PDSEDWPVQAEAKDIISQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQK--AEFVP 1127
            |.:  |  ..|...::.:||:.||..|.   |...:::...|...|:|:::|:::  ..|:|
Mouse   246 PSA--W--SQEMVSLLKKLLEPNPDQRF---SHLTDIQNFPYMSDMNWDAVLQKRLIPGFIP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 86/292 (29%)
S_TKc 835..1110 CDD:214567 84/280 (30%)
PDZ_signaling 1506..1587 CDD:238492
Stk32aNP_848864.1 STKc_Yank1 22..281 CDD:270730 84/281 (30%)
S_TKc 23..270 CDD:214567 83/269 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.