DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and Sgk1

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:NP_001155317.2 Gene:Sgk1 / 20393 MGIID:1340062 Length:524 Species:Mus musculus


Alignment Length:318 Identity:108/318 - (33%)
Similarity:176/318 - (55%) Gaps:22/318 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   825 AQQPSPQENDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDI-LS 888
            :..|..:.:||..:|:|..|::|.|.|.:||.....:|:|.:.|..::.:.:.:.:.:||:: |.
Mouse   181 SSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLK 245

  Fly   889 FADNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHSYG 953
            ...:||:|.::.||:|...|..|::|:.||:....|:.........||||.||...|:.||||..
Mouse   246 NVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLN 310

  Fly   954 IVHRDLKPDNLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVYGTPEYIAPE 1018
            ||:|||||:|:|:.:.|||.||||||.|..:....|          |..|.     |||||:|||
Mouse   311 IVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGT----------TSTFC-----GTPEYLAPE 360

  Fly  1019 VILRQGYGKPVDWWSMGIILYEFLIGCVPFFGETTEELFAHTVNDDIEWPDSEDWPVQAEAKDII 1083
            |:.:|.|.:.||||.:|.:|||.|.|..||:...|.|::.:.:|..::...:    :...|:.::
Mouse   361 VLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPN----ITNSARHLL 421

  Fly  1084 SQLLQQNPRDRLGTQSGALEMKEHEYFLGMDWNSLLRQK--AEFVPQLSHDDDTSYFD 1139
            ..|||::...|||.:...:|:|.|.:|..::|:.|:.:|  ..|.|.:|...|..:||
Mouse   422 EGLLQKDRTKRLGAKDDFMEIKSHIFFSLINWDDLINKKITPPFNPNVSGPSDLRHFD 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 98/281 (35%)
S_TKc 835..1110 CDD:214567 96/275 (35%)
PDZ_signaling 1506..1587 CDD:238492
Sgk1NP_001155317.2 STKc_SGK1 183..521 CDD:270753 108/316 (34%)
S_TKc 191..448 CDD:214567 96/275 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.