DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dop and stk32a

DIOPT Version :9

Sequence 1:NP_001261884.1 Gene:dop / 39686 FlyBaseID:FBgn0267390 Length:2139 Species:Drosophila melanogaster
Sequence 2:XP_002936753.2 Gene:stk32a / 100490429 XenbaseID:XB-GENE-490728 Length:398 Species:Xenopus tropicalis


Alignment Length:304 Identity:93/304 - (30%)
Similarity:161/304 - (52%) Gaps:33/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   833 NDFDIVKLISNGAYGAVYLVKHKTTRQRFAMKKINKNNLILRNQVEQVFAERDILSFADNPFVVS 897
            |.|:|::.|..|::|.|.:|:...|::.:|||.:||...:.||:|..||.|..|:...::||:|:
 Frog    21 NHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKCVERNEVRNVFKELQIMQGLEHPFLVN 85

  Fly   898 MYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLHSYGIVHRDLKPD 962
            ::.||:.::.:.:|::.:.|||....|:..........:.|..|..||::||.|..|:|||:|||
 Frog    86 LWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVRFTEASVKLYICELALALDYLQSKSIIHRDIKPD 150

  Fly   963 NLLITALGHIKLTDFGLSKMGLMSLATNLYEGYIDSETRQFSDKQVYGTPEYIAPEVILRQG--- 1024
            |:|:...||:.:|||.::.  |:|..|.:              ..|.||..|:|||:...:|   
 Frog   151 NVLLDEQGHVHITDFNIAT--LVSKGTKI--------------TTVAGTKPYMAPEMFYPRGQIC 199

  Fly  1025 YGKPVDWWSMGIILYEFLIGCVPF--FGETTEELFAHTVND-DIEWPDSEDWPVQAEAKDIISQL 1086
            |...|||||:|:..||.|.|..||  ...|......|..:. .:.:|.:  |  ..|...::.:|
 Frog   200 YSFGVDWWSLGVTAYELLRGRRPFHIHSSTAATDIVHVFHTATVTYPPA--W--SEEIVSLLHKL 260

  Fly  1087 LQQNPRDRLGTQSGALE-MKEHEYFLGMDWNSLLRQK--AEFVP 1127
            |.:||.:|.    ..|| :::..|...::|::.|:::  .:|:|
 Frog   261 LDRNPEERF----SCLEHIQDFPYLSDVNWDAALQKRLSPQFIP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dopNP_001261884.1 DUF1908 344..702 CDD:286070
STKc_MAST 834..1115 CDD:270760 88/287 (31%)
S_TKc 835..1110 CDD:214567 87/281 (31%)
PDZ_signaling 1506..1587 CDD:238492
stk32aXP_002936753.2 STKc_Yank1 22..281 CDD:270730 87/282 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.