DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and DCUN1D5

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_115675.1 Gene:DCUN1D5 / 84259 HGNCID:28409 Length:237 Species:Homo sapiens


Alignment Length:214 Identity:65/214 - (30%)
Similarity:122/214 - (57%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FCLQQNDWKFELASDNYFQNPEYYYRELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKP 102
            :|..|...:. ::.:.:|.:          |:....|..|..|.:  .:|.:|:..|.||:.::|
Human    30 YCRSQPPARL-ISGEEHFSS----------KKCLAWFYEYAGPDE--VVGPEGMEKFCEDIGVEP 81

  Fly   103 DSKLVLIIAWKFHAEVQCEFSRDEFINGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTF 167
            ::.::|::|||..||....|:::|::.||..|..|..:||:.|...|..:|||...||:.|.:.|
Human    82 ENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAF 146

  Fly   168 NYAKDPGQKGIDLEMAIAYWCIVLSGRFKFLDIWCQFLEEKHKRAISRDTWNLLLDFATNIDDRM 232
            ::|:|..|:.:|::.|.:...::|...:....::.|:||:...|.:::|.|..:|:|:..:...:
Human   147 DFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADL 211

  Fly   233 SNYDSEGAWPVLIDDFVEW 251
            ||||.:||||||:|:||||
Human   212 SNYDEDGAWPVLLDEFVEW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366 3/19 (16%)
Cullin_binding 141..252 CDD:281545 40/111 (36%)
DCUN1D5NP_115675.1 Cullin_binding 120..230 CDD:397562 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53724
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.