DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and AT1G15860

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001185006.1 Gene:AT1G15860 / 838156 AraportID:AT1G15860 Length:236 Species:Arabidopsis thaliana


Alignment Length:207 Identity:69/207 - (33%)
Similarity:107/207 - (51%) Gaps:20/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEF 127
            :|:|  ||:.||.:|.:.|..| |..:|:.....:|::......:|::|||..||.|..|:.:|:
plant    32 KEMD--RIDHLFNQYANKSSSL-IDPEGIEELCSNLEVSHTDIRILMLAWKMKAEKQGYFTHEEW 93

  Fly   128 INGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYA-KDPGQKGIDLEMAIAYWCIVL 191
            ..|:..|..|:|:|||..||.||:|:.....|.|||.:.|.|. .:..||.||:|.......||:
plant    94 RRGLKALRADTINKLKKALPELEKEVRRPSNFADFYAYAFCYCLTEEKQKSIDIETICQLLEIVM 158

  Fly   192 SGRFK--------FLDIWCQFLEEKH-----KRAISRDTWNLLLDFATNID-DRMSNYDSEGAWP 242
            ...|:        :|.:|  ..::.|     .:.|:.|.|..|..|...|. ..|.:|:.|.|||
plant   159 GSTFRAQVDYFVEYLKVW--ITQKSHIIQNDYKVINMDQWMGLYRFCNEISFPDMGDYNPELAWP 221

  Fly   243 VLIDDFVEWCQE 254
            :::|:||||.||
plant   222 LILDNFVEWIQE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 41/125 (33%)
AT1G15860NP_001185006.1 Cullin_binding 107..230 CDD:281545 40/124 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53724
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.