DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and AAR3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_189539.1 Gene:AAR3 / 822537 AraportID:AT3G28970 Length:295 Species:Arabidopsis thaliana


Alignment Length:205 Identity:65/205 - (31%)
Similarity:100/205 - (48%) Gaps:46/205 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 SKLVLIIAWKFHAEVQCEFSRDEFINGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFN 168
            ::|:.::..||.|.           |.:    .|.:.||.::|.::.    |..:|..||.|.|.
plant    50 TQLLYLVENKFQAR-----------NSI----FDELFKLMSRLDLMV----DFTEFTCFYDFVFF 95

  Fly   169 YAKDPGQKGIDLEMAIAYWCIVLSGRFKFLDIWCQFLEEKHKRAISRDTWNLLLDFATNIDDRMS 233
            ..::.|||.|.:..||..|.:||:|||:.|:.||.|:|:..:..||.|||..:|.|:..:.:.:.
plant    96 MCRENGQKNITISRAITAWKLVLAGRFRLLNRWCDFIEKNQRHNISEDTWQQVLAFSRCVHENLE 160

  Fly   234 NYDSEGAWPVLIDDFVE--------------WC------------QENDHLKEDSSPASGYQQ-Q 271
            .||||||||||||||||              :|            ||::|.|:...|.:|.:. .
plant   161 GYDSEGAWPVLIDDFVEHMYSILGPNKDTSLFCKCGDTESESCLYQEDEHHKDYRRPHTGLRNIP 225

  Fly   272 SSASSSSQKN 281
            .....:|:||
plant   226 GLKRKTSKKN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 49/124 (40%)
AAR3NP_189539.1 Cullin_binding 82..179 CDD:281545 46/96 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12281
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.