DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and Dcun1d5

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_030100571.1 Gene:Dcun1d5 / 76863 MGIID:1924113 Length:316 Species:Mus musculus


Alignment Length:188 Identity:62/188 - (32%)
Similarity:115/188 - (61%) Gaps:2/188 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFI 128
            :..||:....|..|..|.:  .:|.:|:..|.||:.::|::.::|::|||..||....|:::|::
Mouse   124 DFSRKKCLAWFYEYAGPDE--VVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWL 186

  Fly   129 NGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSG 193
            .||..|..|..:||:::...|..:|||...||:.|.:.|::|:|..|:.:|::.|.:...::|..
Mouse   187 KGMTSLQCDCTEKLQSRFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGR 251

  Fly   194 RFKFLDIWCQFLEEKHKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEW 251
            .:....::.|:||:...|.:::|.|..:|:|:..:...:||||.:||||||:|:||||
Mouse   252 TWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 39/111 (35%)
Dcun1d5XP_030100571.1 Cullin_binding 199..309 CDD:367560 37/109 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53724
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.