DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and dcun1d3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001096582.1 Gene:dcun1d3 / 557682 ZFINID:ZDB-GENE-070928-2 Length:297 Species:Danio rerio


Alignment Length:210 Identity:76/210 - (36%)
Similarity:112/210 - (53%) Gaps:6/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMCD 133
            ||.::|:.|:|..:. .|..:|:..|..||.:.|....||::||||.|...|:|:|.||::|...
Zfish    88 RIHKMFLCYKDEHED-SILEEGMERFCNDLCVDPAEFKVLVLAWKFQAATMCKFTRREFVDGCKA 151

  Fly   134 LGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKD--PGQKGIDLEMAIAYWCIVLS-GRF 195
            :..|||..:.::..:|.:|......|||.|.|||.:..|  .||:.:...:|||.|.:|.: ...
Zfish   152 IQADSIPGICSRFSVLLEESRGEESFKDLYRFTFQFGLDAEQGQRSLQRSIAIALWRLVFTLDTP 216

  Fly   196 KFLDIWCQFLEEK--HKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQENDHL 258
            ..|:.|..||.|.  ..|.|||||||:.|:|..:|...:|||..:.|||.|.|.||||..|....
Zfish   217 PVLERWLDFLSENPCAVRGISRDTWNMFLNFTQSIGQDLSNYSEDEAWPSLFDSFVEWETERRRR 281

  Fly   259 KEDSSPASGYQQQSS 273
            :...:..:|..:.||
Zfish   282 EHTETDPNGDCEASS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 44/115 (38%)
dcun1d3NP_001096582.1 Cullin_binding 167..274 CDD:281545 43/106 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.