DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and dcun1d5

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001016303.1 Gene:dcun1d5 / 549057 XenbaseID:XB-GENE-1015346 Length:232 Species:Xenopus tropicalis


Alignment Length:240 Identity:69/240 - (28%)
Similarity:129/240 - (53%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KLKSSTHRDKVKKFISLTHTGEQTAIFCLQQNDWKFELASDNYFQNPEYYYRELDRKRIEQLFMR 76
            |.||::..:...|...:|.       :|..|...|. :..::.|.:          |:....|..
 Frog     6 KRKSNSSEEMNLKKCRITS-------YCRSQATSKI-INGEDLFSS----------KKCLAWFYE 52

  Fly    77 YRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMCDLGIDSIDK 141
            |..|.:  .:|.:.:..|.||:.::|::.::.::|||..||....|:::|::.||..|..|..:|
 Frog    53 YAGPDE--IVGPEAMEKFCEDIGVEPENIIMSVLAWKLEAENMGFFTKEEWLKGMTSLQCDCTEK 115

  Fly   142 LKTKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSGRFKFLDIWCQFLE 206
            |::|...|..:|||...||:.|.:.|::|:|..|:.:|::.|.:...::|...:....::.|:||
 Frog   116 LQSKFDFLRAQLNDITAFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLE 180

  Fly   207 EKHKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEW 251
            :...|.:::|.|..:|:|:..:...:||||.:||||||:|:||||
 Frog   181 QSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEW 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366 9/45 (20%)
Cullin_binding 141..252 CDD:281545 40/111 (36%)
dcun1d5NP_001016303.1 Cullin_binding 115..225 CDD:281545 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.