DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and dcun1d5

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005173664.1 Gene:dcun1d5 / 406622 ZFINID:ZDB-GENE-040426-2603 Length:249 Species:Danio rerio


Alignment Length:240 Identity:68/240 - (28%)
Similarity:126/240 - (52%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KLKSSTHRDKVKKFISLTHTGEQTAIFCLQQNDWKFELASDNYFQNPEYYYRELDRKRIEQLFMR 76
            |.|||...|...:...:|.       :|..|...:        ..|||.::   ..|:....|..
Zfish    23 KRKSSGSEDPSIRKCKITS-------YCRTQTSGR--------LVNPEDHF---SNKKCLAWFYE 69

  Fly    77 YRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMCDLGIDSIDK 141
            |....|  .:|.:.:..|.||:.::|::.::|::|||..|.....|:::|::.||..|..|..::
Zfish    70 YAGSDD--IVGPESMEKFCEDIGVEPENIVMLVLAWKLEATNMGFFTKEEWLKGMTSLHCDGTER 132

  Fly   142 LKTKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSGRFKFLDIWCQFLE 206
            |:.||..:...|||...||..|.:.|::|:|..|:.:|::.|.:...::|...:....::.||||
Zfish   133 LQGKLDYMRSLLNDPVIFKSIYRYAFDFARDKDQRSLDMDTAKSMLALLLGRTWPLFPVFHQFLE 197

  Fly   207 EKHKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEW 251
            :...:.:::|.|..:|:|:..::..:||||.:|||||::|:||:|
Zfish   198 QSKYKVMNKDQWYNVLEFSRTVNADLSNYDEDGAWPVMLDEFVDW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366 8/45 (18%)
Cullin_binding 141..252 CDD:281545 37/111 (33%)
dcun1d5XP_005173664.1 Cullin_binding 133..242 CDD:281545 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53724
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.