DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and SCCRO4

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001287127.1 Gene:SCCRO4 / 40231 FlyBaseID:FBgn0036967 Length:248 Species:Drosophila melanogaster


Alignment Length:185 Identity:66/185 - (35%)
Similarity:109/185 - (58%) Gaps:0/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGM 131
            :||....|..|..|.:|..:|..|:..|.||:.::|::.::|::|:|..|.....||:.|::.|:
  Fly    49 QKRCMAWFQEYTTPDEPETLGPDGMEKFCEDIGVEPENIVMLVLAYKMGATQMGFFSQQEWLKGL 113

  Fly   132 CDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSGRFK 196
            .:|..||..|:..||..|...|||...||..|.:.:::|||..|:.:|:..|.|...::|...:.
  Fly   114 TELDCDSAAKMVVKLDYLRSILNDPNSFKSIYRYAYDFAKDSDQRCMDILTAKAMLQLLLGKHWP 178

  Fly   197 FLDIWCQFLEEKHKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEW 251
            ....:.||||:...:||::|.|..:|:|:..|...:||||.:|||||::|:||||
  Fly   179 LYPQFAQFLEQSKYKAINKDQWCNILEFSRTISIDLSNYDIDGAWPVMLDEFVEW 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 43/111 (39%)
SCCRO4NP_001287127.1 Cullin_binding 123..234 CDD:281545 43/111 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442192
Domainoid 1 1.000 83 1.000 Domainoid score I5335
eggNOG 1 0.900 - - E1_KOG3077
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1488
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112210at33392
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 1 1.000 - - otm46822
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.