DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and SCCRO3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_610828.2 Gene:SCCRO3 / 36426 FlyBaseID:FBgn0033784 Length:334 Species:Drosophila melanogaster


Alignment Length:195 Identity:73/195 - (37%)
Similarity:107/195 - (54%) Gaps:13/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFI 128
            |:..:.:.:||..|:||.|...|.:.|:.....||:.:||...:|::||...|...|.|::.|||
  Fly   111 EVSHQTLSKLFDVYKDPDDEEMILTDGIERLCNDLNYQPDEFAILVLAWCLDASQMCRFTKVEFI 175

  Fly   129 NGMCDLGIDSIDKLKTKLPILEQELN----DAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCI 189
            .|:..:..|:||.::.:   |||.:.    ||..||..|.|||.:..:|.|:.:.|||||..|.:
  Fly   176 EGLHKMRADTIDSIRVR---LEQTIEMLKADAEMFKQLYRFTFRFGLEPDQRVLSLEMAIDLWKL 237

  Fly   190 VLSGRFKFL-DIWCQFLEEKHK--RAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEW 251
            |.:.:...| ..|..|| |||.  |.|.:||||:.|:|....|  :.|||...|||.|.||||::
  Fly   238 VFTVQTPDLFSNWIHFL-EKHPNIRRIPKDTWNMYLNFTEQCD--IQNYDDTEAWPSLFDDFVDY 299

  Fly   252  251
              Fly   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 47/118 (40%)
SCCRO3NP_610828.2 Cullin_binding 180..299 CDD:281545 50/124 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1488
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 1 1.000 - - otm46822
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.