DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and Dcun1d3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001020057.1 Gene:Dcun1d3 / 309035 RGDID:1308893 Length:304 Species:Rattus norvegicus


Alignment Length:196 Identity:80/196 - (40%)
Similarity:107/196 - (54%) Gaps:6/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFI 128
            |...:|:|:||.||:|..:. .|..:|:..|..||.:.|....||::||||.|...|:|:|.||.
  Rat    85 ESSLQRLEELFRRYKDERED-AILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFF 148

  Fly   129 NGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKD--PGQKGIDLEMAIAYWCIVL 191
            :|...:..||||.:..:.|.|..|.....||||.|.|||.:..|  .||:.:..|:|||.|.:|.
  Rat   149 DGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVF 213

  Fly   192 S-GRFKFLDIWCQFLEEKHK--RAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQ 253
            : .....||.|..||.|...  :.|||||||:.|:|...|...:|||..:.|||.|.|.||||..
  Rat   214 TQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEM 278

  Fly   254 E 254
            |
  Rat   279 E 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 47/115 (41%)
Dcun1d3NP_001020057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87 1/1 (100%)
Cullin_binding 164..276 CDD:397562 46/111 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.