DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and Dcun1d3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001157175.1 Gene:Dcun1d3 / 233805 MGIID:2679003 Length:304 Species:Mus musculus


Alignment Length:230 Identity:86/230 - (37%)
Similarity:118/230 - (51%) Gaps:15/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFI 128
            |...:|:|:||.||:|..:. .|..:|:..|..||.:.|....||::||||.|...|:|:|.||.
Mouse    85 ESSLQRLEELFRRYKDERED-AILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFF 148

  Fly   129 NGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKD--PGQKGIDLEMAIAYWCIVL 191
            :|...:..||||.:..:.|.|..|.....||||.|.|||.:..|  .||:.:..|:|||.|.:|.
Mouse   149 DGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVF 213

  Fly   192 S-GRFKFLDIWCQFLEEKHK--RAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQ 253
            : .....||.|..||.|...  :.|||||||:.|:|...|...:|||..:.|||.|.|.||||  
Mouse   214 TQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEW-- 276

  Fly   254 ENDHLKEDSSPASGYQQQSSASSSSQKNISSAYQT 288
            |.:..|.:       .:.....||.|:.:....||
Mouse   277 EMERRKRE-------VEGRGTLSSGQEGLCPEEQT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 47/115 (41%)
Dcun1d3NP_001157175.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87 1/1 (100%)
Cullin_binding 164..276 CDD:397562 46/111 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..304 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.