DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and DCUN1D3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_775746.1 Gene:DCUN1D3 / 123879 HGNCID:28734 Length:304 Species:Homo sapiens


Alignment Length:230 Identity:86/230 - (37%)
Similarity:118/230 - (51%) Gaps:15/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ELDRKRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFI 128
            |...:|:|:||.||:|..:. .|..:|:..|..||.:.|....||::||||.|...|:|:|.||.
Human    85 ESSLQRLEELFRRYKDERED-AILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFF 148

  Fly   129 NGMCDLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKD--PGQKGIDLEMAIAYWCIVL 191
            :|...:..||||.:..:.|.|..|.....||||.|.|||.:..|  .||:.:..|:|||.|.:|.
Human   149 DGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVF 213

  Fly   192 S-GRFKFLDIWCQFLEEKHK--RAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQ 253
            : .....||.|..||.|...  :.|||||||:.|:|...|...:|||..:.|||.|.|.||||  
Human   214 TQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEW-- 276

  Fly   254 ENDHLKEDSSPASGYQQQSSASSSSQKNISSAYQT 288
            |.:..|.:.       :...|.||..:.:....||
Human   277 EMERRKREG-------EGRGALSSGPEGLCPEEQT 304

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 47/115 (41%)