DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and Dcun1d4

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001177663.1 Gene:Dcun1d4 / 100737 MGIID:2140972 Length:306 Species:Mus musculus


Alignment Length:241 Identity:71/241 - (29%)
Similarity:120/241 - (49%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSSTHRDKVKKFISLTHTGEQTAIFCLQQNDWKFELASDNYFQNPEYYYRELDRKRIEQLFMRYR 78
            |.|.|....:|:.|.....|:.|                            ...||..:.|..|.
Mouse    92 KKSRHDSMYRKYESTRIKTEEEA----------------------------FSSKRCLEWFYEYA 128

  Fly    79 DPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMCDLGIDSIDKLK 143
            ...|  .:|.:|:..|.||:.::|::.::|::|||..|:....|:..|::.||..|..|:.:||:
Mouse   129 GTED--AVGPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLR 191

  Fly   144 TKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSGRFKFLDIWCQFLEEK 208
            |.|..|...|||...||..|.:.|::|::..|:.:|:..|.....::|...:....::.||||:.
Mouse   192 TTLDYLRSLLNDTTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQS 256

  Fly   209 HKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQE 254
            ..:.|::|.|..:|:|:..|...:||||.:||||||:|:||||.::
Mouse   257 KYKVINKDQWCNVLEFSRTISLDLSNYDEDGAWPVLLDEFVEWYKD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366 7/43 (16%)
Cullin_binding 141..252 CDD:281545 41/110 (37%)
Dcun1d4NP_001177663.1 Cullin_binding 189..300 CDD:281545 41/110 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833252
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53724
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.