DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and dcun1d2

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001120037.1 Gene:dcun1d2 / 100145003 XenbaseID:XB-GENE-5884080 Length:259 Species:Xenopus tropicalis


Alignment Length:249 Identity:156/249 - (62%)
Similarity:193/249 - (77%) Gaps:6/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 INKLKSSTHRDKVKKFISLTHTGEQTAIFCLQQNDWKFELASDNYFQNPEYYYRE-----LDRKR 69
            ::||||| .:|||::|::.|..||:|||:||.|||||.|||:||||||...|.:|     :|:|:
 Frog     1 MHKLKSS-QKDKVRQFMAFTQAGERTAIYCLTQNDWKLELATDNYFQNTSLYCKESMKSTVDKKK 64

  Fly    70 IEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMCDL 134
            :|||:.||:||.|..|||..|:..|.:||.|.|.|..||:|||||.|..|||||:.|||:||.:|
 Frog    65 LEQLYNRYKDPQDENKIGIDGIQLFCDDLHLDPASTSVLVIAWKFRAATQCEFSKKEFIDGMTEL 129

  Fly   135 GIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKDPGQKGIDLEMAIAYWCIVLSGRFKFLD 199
            |.||.|||:.:||.|||:|.|..||||||.||||:||:|||||:||:||:|||.:||||||||||
 Frog   130 GCDSTDKLRAQLPRLEQDLKDPLKFKDFYQFTFNFAKNPGQKGLDLDMAVAYWNLVLSGRFKFLD 194

  Fly   200 IWCQFLEEKHKRAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQ 253
            :|..||.|.|||:|.:|||||||||...|.|.|||||.|||||||||||||:.:
 Frog   195 LWNTFLLEHHKRSIPKDTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEYAR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366 30/46 (65%)
Cullin_binding 141..252 CDD:281545 80/110 (73%)
dcun1d2NP_001120037.1 UBA_DCNL2 2..47 CDD:270595 29/45 (64%)
Cullin_binding 136..246 CDD:367560 79/109 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.