DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCCRO and dcun1d3

DIOPT Version :9

Sequence 1:NP_001246770.1 Gene:SCCRO / 39685 FlyBaseID:FBgn0036510 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_012825424.1 Gene:dcun1d3 / 100124860 XenbaseID:XB-GENE-6258756 Length:341 Species:Xenopus tropicalis


Alignment Length:213 Identity:84/213 - (39%)
Similarity:115/213 - (53%) Gaps:8/213 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KRIEQLFMRYRDPSDPLKIGSQGVIHFLEDLDLKPDSKLVLIIAWKFHAEVQCEFSRDEFINGMC 132
            :|||:||.||:|..:. .|..:|:..|..||.:.|....||::||||.|...|:|:|.||..|..
 Frog   126 QRIEELFWRYKDERED-AILEEGMERFCNDLYVDPTEFRVLVLAWKFQAATMCKFTRREFFEGCK 189

  Fly   133 DLGIDSIDKLKTKLPILEQELNDAGKFKDFYHFTFNYAKD--PGQKGIDLEMAIAYWCIVLS-GR 194
            .:..|.|:.:..:.|.|..|.....||||.|.|||.:..|  .||:.:..|:|||.|.:|.: .:
 Frog   190 AINADGIEGICARFPSLLNEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVFTQNK 254

  Fly   195 FKFLDIWCQFLEEKHK--RAISRDTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQENDH 257
            ...||.|..||.|...  :.|||||||:.|:|...|...:|||..:.|||.|.|.||||..|...
 Frog   255 PLILDQWLDFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRK 319

  Fly   258 LKEDSS--PASGYQQQSS 273
            .:|::.  |.||...||:
 Frog   320 NEEETKCIPCSGTDDQST 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCCRONP_001246770.1 UBA_like_SF 11..58 CDD:304366
Cullin_binding 141..252 CDD:281545 47/115 (41%)
dcun1d3XP_012825424.1 Cullin_binding 198..313 CDD:281545 46/114 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418097at2759
OrthoFinder 1 1.000 - - FOG0000501
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.