powered by:
Protein Alignment AGO2 and R06C7.2
DIOPT Version :9
Sequence 1: | NP_730054.1 |
Gene: | AGO2 / 39683 |
FlyBaseID: | FBgn0087035 |
Length: | 1217 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492044.2 |
Gene: | R06C7.2 / 187640 |
WormBaseID: | WBGene00011062 |
Length: | 233 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 33/74 - (44%) |
Gaps: | 23/74 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 1112 PNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCN--RSVSYPAPAYL 1174
|.::.||::| ||. :||:::.:..|..|.:.: :.:.:|.|.|:
Worm 120 PLQILFFLIS----------------END-----ELLERVFHFHCATFTKLSDFQLLFFPTPMYV 163
Fly 1175 AHLVAARGR 1183
|:..|..||
Worm 164 ANEYAKSGR 172
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1041 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.