DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AGO2 and R06C7.2

DIOPT Version :9

Sequence 1:NP_730054.1 Gene:AGO2 / 39683 FlyBaseID:FBgn0087035 Length:1217 Species:Drosophila melanogaster
Sequence 2:NP_492044.2 Gene:R06C7.2 / 187640 WormBaseID:WBGene00011062 Length:233 Species:Caenorhabditis elegans


Alignment Length:74 Identity:17/74 - (22%)
Similarity:33/74 - (44%) Gaps:23/74 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1112 PNEMQFFMVSHQAIQGTAKPTRYNVIENTGNLDIDLLQQLTYNLCHMFPRCN--RSVSYPAPAYL 1174
            |.::.||::|                ||.     :||:::.:..|..|.:.:  :.:.:|.|.|:
 Worm   120 PLQILFFLIS----------------END-----ELLERVFHFHCATFTKLSDFQLLFFPTPMYV 163

  Fly  1175 AHLVAARGR 1183
            |:..|..||
 Worm   164 ANEYAKSGR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AGO2NP_730054.1 PLN03202 411..1180 CDD:215631 14/69 (20%)
ArgoN 411..543 CDD:293095
ArgoL1 554..601 CDD:285861
PAZ 605..719 CDD:239207
Piwi_ago-like 764..1186 CDD:240015 17/74 (23%)
R06C7.2NP_492044.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.