DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and CREB3L3

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_115996.1 Gene:CREB3L3 / 84699 HGNCID:18855 Length:461 Species:Homo sapiens


Alignment Length:387 Identity:102/387 - (26%)
Similarity:159/387 - (41%) Gaps:129/387 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 LEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICSDIEIDE--SAIKDEPM--SPDS---------- 221
            ::.|:|...|:|.         :||     |...:|:.|  ..:||:.:  :|||          
Human    20 IDSFELLDLLFDR---------QDG-----ILRHVELGEGWGHVKDQQVLPNPDSDDFLSSILGS 70

  Fly   222 --SCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQD 284
              |.|:||                      |:.|:                           |.|
Human    71 GDSLPSSP----------------------LWSPE---------------------------GSD 86

  Fly   285 NLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPLTPPSSL-PSDDSEG---NLSPEHLFAPLSP--- 342
            :.:  ..::.|:.|.|...|.         |.|.|:.. |:...:|   :..|.:..:..:|   
Human    87 SGI--SEDLPSDPQDTPPRSG---------PATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPV 140

  Fly   343 ------NATVSISVANPAGG----------ESSVRVSRTAASITRS-SSGSASASGSSTSSTVTT 390
                  :.|:.:.:.:|.|.          :.|.|.:.|...:..| |||.........|..:  
Human   141 IQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLL-- 203

  Fly   391 TRQPIHTPLISSQP-KGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKIS 454
                        :| .|....|:|||:||:.|..||..:|.:|||||.||:.||||||||:||.|
Human   204 ------------RPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQS 256

  Fly   455 AQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKHNVKKS 516
            |||||:|||||:|.||.|:.....:|.:.::::..||:.|.:||.||.||||:|.:...|.:
Human   257 AQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 23/49 (47%)
coiled coil 452..495 CDD:269837 19/42 (45%)
CREB3L3NP_115996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..120 20/128 (16%)
DUF2207 <169..>266 CDD:303056 45/110 (41%)
bZIP_CREB3 244..304 CDD:269837 32/59 (54%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 245..274 23/28 (82%)
coiled coil 246..297 CDD:269837 26/50 (52%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 285..306 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..408
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144423
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40574
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3645
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.