DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Creb3l4

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_006502373.5 Gene:Creb3l4 / 78284 MGIID:1916603 Length:445 Species:Mus musculus


Alignment Length:315 Identity:93/315 - (29%)
Similarity:140/315 - (44%) Gaps:45/315 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 PASPTSQA---------SSSQHQLSLNLAHLQSEM--------LFEPKH----CGLLLTASSNSN 267
            |.:|..|:         :||..|..|.|..|...:        |.||..    .|..|....|..
Mouse    40 PGNPVYQSLLSQLFADETSSPQQDLLALRKLTERVNMELGCPELLEPPEDIFSTGSFLELGFNGP 104

  Fly   268 NSLIKSQQRQQQILGQD--NLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPLTPPSSLPSDDSEGN 330
            .|.:...:..|:....|  ||.:....|...:  ||...|...:...|.|....||.|:      
Mouse   105 ASKVPVTRGLQKSEPDDFLNLFIDPNMIHCSE--TSPGRDSGVSEDPGSPAQQASSSPA------ 161

  Fly   331 LSPEHLFAPLSPNATV--SISVANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTV---TT 390
                 |:..:..:.|:  :...|.|..|..|:::.:...::....:.:.|...|.:...:   .:
Mouse   162 -----LYEVVYDSGTLQGTQREAGPTFGLISIQIDQWTPALMVPDACTVSGLPSDSHRHILPRVS 221

  Fly   391 TRQPIHTPLISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISA 455
            ||.|.....:.|    ....|.||:|||:.|..||..:|..||||||||:.||||||||:||.||
Mouse   222 TRAPAPPAAMPS----CQHHLFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSA 282

  Fly   456 QESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSK 510
            |:|||:||||:|.||.||.....:|...:::::.||..|..|:.|:.:||.|.::
Mouse   283 QDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 22/49 (45%)
coiled coil 452..495 CDD:269837 19/42 (45%)
Creb3l4XP_006502373.5 bZIP_CREB3 269..329 CDD:269837 31/59 (53%)
coiled coil 271..322 CDD:269837 26/50 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834554
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.