DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and atf6b

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001071188.1 Gene:atf6b / 777612 ZFINID:ZDB-GENE-061103-166 Length:673 Species:Danio rerio


Alignment Length:298 Identity:73/298 - (24%)
Similarity:112/298 - (37%) Gaps:95/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 SLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPLTPPSSLPSDD------- 326
            |:::.:....|.|..|.....|.|                      |.:|.|||.||.       
Zfish    78 SILRDEATVTQPLPVDMFFQVKTE----------------------PPSPASSLTSDSSIPAVCE 120

  Fly   327 ------SEGNLSPEHLF----APLSPNATVSISVAN------PAGGESSVRVSRTAASITRSSSG 375
                  ||...:|.:::    ||  |.|.|.::||:      |....:...|...||::..||..
Zfish   121 SQVMVKSENPPTPPYMYGDVLAP--PLAGVEVTVASAPQPAVPLSAHTHTTVLSPAATLKASSIV 183

  Fly   376 SAS--------------ASGSSTSSTVTTTRQ---PIHTPLI--SSQPKGSTGTLLLTEEE---K 418
            |:.              .:.|:|::.....:.   |:..|.:  ||.|...:.::.|....   |
Zfish   184 SSKPLLQPKPVCVTALPVAPSATAAKALILQSVPVPVPVPTLEQSSTPVVLSPSVCLAPAPAIVK 248

  Fly   419 RTLLAEGYP------IPQKLPLTKA-------------EEKSLKKIRRKIKNKISAQESRRKKKE 464
            ...|:...|      .||..|:..|             :.|.||:.:|.|||:.||.:||:||||
Zfish   249 MEPLSPSMPHCSSPSAPQSKPIVPATAAALPGNIGSDIDMKVLKRQQRMIKNRESACQSRKKKKE 313

  Fly   465 YMDQLERRV-------EILVTENHDYKKRLEGLEETNA 495
            |:..||.::       |.|..|||..:.||.|.|.|.:
Zfish   314 YLQNLETQLRDAQQENERLRRENHTLRLRLAGKEATES 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 21/51 (41%)
coiled coil 452..495 CDD:269837 21/49 (43%)
atf6bNP_001071188.1 bZIP_ATF6 293..343 CDD:269848 20/49 (41%)
coiled coil 293..343 CDD:269848 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.