DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and CREB3L2

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_919047.2 Gene:CREB3L2 / 64764 HGNCID:23720 Length:520 Species:Homo sapiens


Alignment Length:430 Identity:147/430 - (34%)
Similarity:199/430 - (46%) Gaps:126/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DPKYLTFHVPPTHATP---------ISRLSSNPALN------------TSVADLTRSSGLQSLQA 154
            |.:.|.:|   ||.:.         :.:|.::|.|:            ||.|.|.::....|| .
Human    26 DGEALMYH---THFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSPTSPAPLIQAEHSYSL-C 86

  Fly   155 HQPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICSDIEIDESAIKDEPMSP 219
            .:|...|..:|:..::        ...|::..|     ....:|.|..|      ::||.||:: 
Human    87 EEPRAQSPFTHITTSD--------SFNDDEVES-----EKWYLSTDFPS------TSIKTEPVT- 131

  Fly   220 DSSCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQD 284
            |...|....|..                          |.:||.|   ..|.|.:...:...|.|
Human   132 DEPPPGLVPSVT--------------------------LTITAIS---TPLEKEEPPLEMNTGVD 167

  Fly   285 N---LLMAKMEIK-SEKQSTSNSSDK----SHAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLS 341
            :   .::.|:::: .|.....|.|.|    .|.|   :|.|||||..| ||||:|||.....|.|
Human   168 SSCQTIIPKIKLEPHEVDQFLNFSPKEAPVDHLH---LPPTPPSSHGS-DSEGSLSPNPRLHPFS 228

  Fly   342 -PNATVSISVANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPIHTPLISSQPK 405
             |.                          |.|.|.:|..:.|:.||          :||:::..|
Human   229 LPQ--------------------------THSPSRAAPRAPSALSS----------SPLLTAPHK 257

  Fly   406 --GSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQ 468
              || |.|:|||||||||:|||||||.||||:|:|||:||||||||||||||||||||||||||.
Human   258 LQGS-GPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDS 321

  Fly   469 LERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALV 508
            ||::||...|||.:.:|::|.||.||..||.||.|||.||
Human   322 LEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 32/49 (65%)
coiled coil 452..495 CDD:269837 28/42 (67%)
CREB3L2NP_919047.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..264 32/109 (29%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 296..325 27/28 (96%)
bZIP_CREB3 305..348 CDD:269837 28/42 (67%)
coiled coil 305..348 CDD:269837 28/42 (67%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 336..357 10/20 (50%)
S1P recognition. /evidence=ECO:0000303|PubMed:17178827 427..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144418
Domainoid 1 1.000 88 1.000 Domainoid score I7931
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 1 1.000 - - FOG0003444
OrthoInspector 1 1.000 - - otm40574
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46004
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3645
SonicParanoid 1 1.000 - - X2341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.