DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and creb1a

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_957203.1 Gene:creb1a / 573207 ZFINID:ZDB-GENE-040426-750 Length:318 Species:Danio rerio


Alignment Length:385 Identity:73/385 - (18%)
Similarity:128/385 - (33%) Gaps:123/385 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ISRLSSNPALNTSVADLTRSSGLQSLQAHQPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSS 191
            :|..::..:.......|.:....|::|.|.....:..|.:....::..|:......:|...||.|
Zfish    31 VSMAAAQASATAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESDDSQESVDS 95

  Fly   192 LRDGSMSPDICS----------DIEIDESAIK--DEPMSPDSSCPA-------SPTSQASSSQHQ 237
            :.|.....:|.|          |:..|..|:.  :|..|.:.|.||       :|..|.||.|: 
Zfish    96 VTDSQKRREILSRRPSYRKILNDLSSDAPAVPRIEEEKSEEDSTPAITTVTVPTPIYQTSSGQY- 159

  Fly   238 LSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSN 302
                :|..|.         |.:..|::.::.           :.|...|.|...           
Zfish   160 ----IAITQG---------GAIQLANNGTDG-----------VQGLQTLTMTNA----------- 189

  Fly   303 SSDKSHAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSISVANPAGGESSVRVSRTAA 367
                                               |...|..|: :..|..:.|:..:..|... 
Zfish   190 -----------------------------------AGAQPGTTI-LQYAQTSDGQQILVPSNQV- 217

  Fly   368 SITRSSSGSASASGSSTSSTVTTTRQPIHTPLISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKL 432
             :.:::||...|....|::..|.....:    ::|.|                          .|
Zfish   218 -VVQAASGDVQAYQIRTAAASTIAPGVV----MASSP--------------------------AL 251

  Fly   433 PLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEE 492
            |...|||.:.|:..|.:||:.:|:|.|||||||:..||.||.:|..:|....:.|:.|::
Zfish   252 PSQGAEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 17/41 (41%)
coiled coil 452..495 CDD:269837 17/41 (41%)
creb1aNP_957203.1 pKID 91..131 CDD:280355 9/39 (23%)
bZIP_CREB1 262..316 CDD:269838 21/50 (42%)
coiled coil 263..315 CDD:269838 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.