DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and ATF1

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_016874820.1 Gene:ATF1 / 466 HGNCID:783 Length:279 Species:Homo sapiens


Alignment Length:257 Identity:64/257 - (24%)
Similarity:103/257 - (40%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 SEKQSTSNSSDK--SHAHGYGIPLTPPS------SLPSDDSEGNLS----------------PEH 335
            ||.:.:.:|||.  |....:||....||      .|.|:|:.|...                |..
Human    44 SESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTP 108

  Fly   336 L-------FAPLSPNATVSISVANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQ 393
            :       :..::||.  ::.:|:|  |...|:..:|   :|.::|||.....:......|:..|
Human   109 IYQTSSGQYIAIAPNG--ALQLASP--GTDGVQGLQT---LTMTNSGSTQQGTTILQYAQTSDGQ 166

  Fly   394 PIHTP---LISSQPKGSTGTLLLTEEEKRTLLAEGY----PIPQKLPLTKAEEKSLKKIRRKIKN 451
            .|..|   ::.....|...|..:......|.|.:..    |:......||.::..||:..|.:||
Human   167 QILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKN 231

  Fly   452 KISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKHNV 513
            :.:|:|.|||||||:..||.||.:              ||..|..|:.:|..|:.|.|..:|
Human   232 REAARECRRKKKEYVKCLENRVAV--------------LENQNKTLIEELKTLKDLYSNKSV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 17/49 (35%)
coiled coil 452..495 CDD:269837 15/42 (36%)
ATF1XP_016874820.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.