DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Atf6b

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_006256045.1 Gene:Atf6b / 406169 RGDID:1303317 Length:741 Species:Rattus norvegicus


Alignment Length:505 Identity:114/505 - (22%)
Similarity:186/505 - (36%) Gaps:141/505 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PES-LKISPDHDMHDWLFDRDVKDPTVILNDKLIS-----DALLNGTQPIKTEHSYSLSSDVDSL 76
            ||: |.:.....|.:.:...::.|||....|.|:|     ..|.:|...:..|.:.........:
  Rat    35 PENRLMVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTQLFRCVEQDV 99

  Fly    77 PDSPKSLQAKIEDMDDECFPAISPKTATNGRVTIDPKYLTFHVPPTHATPI---SRLSSNPALNT 138
            |....||..                    |...|.|:      ||....||   .::.|.|:...
  Rat   100 PFDSSSLDV--------------------GMDVIPPE------PPWDPLPIFPDLQVKSEPSSPC 138

  Fly   139 SVADLTRSSGLQSLQAHQPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICS 203
            |      ||.|.|..:|.....|.            |:|:       ...|..::..|::|.:| 
  Rat   139 S------SSSLSSESSHLSTEPSS------------QVPR-------VGEVLQVKMESLAPPLC- 177

  Fly   204 DIEIDESAIKDEPMSPDSSCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNN 268
                   .:.|:        ||.|......:....|.:||.:|:::  ||..    .::|.||..
  Rat   178 -------LLGDD--------PAFPFETVQITVGSASDDLADIQTKL--EPAS----PSSSVNSEA 221

  Fly   269 SLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPL--TPPSSLPSDDSEGNL 331
            ||:.:....|.::|::.|     |:|:|..|..           |..|  .|.|||.:.......
  Rat   222 SLLSADSPSQALIGEEVL-----EVKTESPSPP-----------GCLLWDVPASSLGAVQISMGK 270

  Fly   332 SPEHLFAPLSPNATVSISV-ANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPI 395
            :|.....||.|...|..:| ..|..|.:|     ||..:.                  ...:||.
  Rat   271 APAPRKPPLQPKPVVLTTVPVPPRAGPAS-----TAVLLQ------------------PLVQQPA 312

  Fly   396 HTPL------ISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKIS 454
            .:|:      |.:||:|....  ....|:::::..  |:|......:.:.|.||:.:|.|||:.|
  Rat   313 VSPVVLIQGAIRAQPEGPAPA--APRPERKSIVPA--PMPGNACPPEVDAKLLKRQQRMIKNRES 373

  Fly   455 AQESRRKKKEYMDQLERRVEILVTENHD-------YKKRLEGLEETNANL 497
            |.:||||||||:..||.|::.::.:|..       .::|||.|...|:.|
  Rat   374 ACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSEL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 20/53 (38%)
coiled coil 452..495 CDD:269837 18/49 (37%)
Atf6bXP_006256045.1 PHA03160 <271..337 CDD:165431 18/90 (20%)
bZIP_ATF6 363..414 CDD:269848 19/50 (38%)
coiled coil 363..414 CDD:269848 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.