DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Atf6

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_995745.1 Gene:Atf6 / 35480 FlyBaseID:FBgn0033010 Length:741 Species:Drosophila melanogaster


Alignment Length:373 Identity:77/373 - (20%)
Similarity:136/373 - (36%) Gaps:96/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 NLEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICSD---IEIDESAIKDE--PMSPDSSCPASPTS 229
            |:.|..|....:.||.|..:|.|     .||:..:   :....:.|..|  ..||.|.....|: 
  Fly    26 NIVHDILNSSAFYNDTSLDLSEL-----IPDLQKEAFGLHFSSNPITSEFSLSSPISGLKQIPS- 84

  Fly   230 QASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQDNLLMAKMEIK 294
             |.|.:.:.::|..:.|.::              :||.|.|.:......:.|.:.|:        
  Fly    85 -ACSGEFKRNVNDNNFQLDL--------------TNSRNDLPEPNSSPTRSLNRSNV-------- 126

  Fly   295 SEKQSTSNSSDKSHAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSISVANPAG---- 355
                   |......|       ..|..:.||..:....|..:   .|||...:.:::|.:.    
  Fly   127 -------NGCSNEEA-------VYPLLVDSDKFDPFFEPAKV---RSPNKEFNSTISNLSDIKNE 174

  Fly   356 --------GESSVRVSRTAASITRSSSGSASAS-GSSTSSTVTTTRQPIHTPLISSQPKGSTGTL 411
                    |.:|...||..:::|:|...:...: .:....||....:.|:.|  |...||...|:
  Fly   175 LPETSQDLGFNSYNTSRNNSTLTKSWPINTELNLDNQVPKTVLPLSRTIYLP--SHDYKGLLPTV 237

  Fly   412 --------------------LLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQ 456
                                ::.:::..|.:..   :.:..|....::|..||.:|.|||:.||.
  Fly   238 KCNGDRTLKKNVNVRSKISNIVIKKKNATFIQS---LKESTPSHTMDDKIYKKYQRMIKNRESAS 299

  Fly   457 ESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKL 504
            .||:|:|||:..||.|:..|       :|..:.|:..|..|..|:..|
  Fly   300 LSRKKRKEYVVSLETRINKL-------EKECDSLKAENITLRDQIFLL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 17/49 (35%)
coiled coil 452..495 CDD:269837 14/42 (33%)
Atf6NP_995745.1 bZIP_ATF6 287..338 CDD:269848 22/57 (39%)
coiled coil 287..338 CDD:269848 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.