DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Atf1

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001094365.1 Gene:Atf1 / 315305 RGDID:1307360 Length:268 Species:Rattus norvegicus


Alignment Length:300 Identity:67/300 - (22%)
Similarity:119/300 - (39%) Gaps:85/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SNSNNSLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSNSSDK--SHAHGYGIPLTPPS------ 320
            |:.:|:...:.|....:.|..:.::.::...||.:.:.:|||.  |....:||....||      
  Rat     4 SHKSNTSETASQPGSTVPGIISQIVHQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILK 68

  Fly   321 SLPSDDSEGNLS---------------PEHL-------FAPLSPNATVSISVANPAGGESSVRVS 363
            .|.|:|:.|...               |..:       :..::||..:.::...|.|.::...::
  Rat    69 DLSSEDTRGRKGDGENPSISAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGPDGVQALQTLT 133

  Fly   364 RTAAS---------ITRSSSGS-----------ASASGSSTSSTVTTTRQPIHTPLISSQPKGST 408
            .|.:|         ..::|.|.           .:|||...:..:.|      ||..:|.|:   
  Rat   134 MTNSSSAQQGAILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRT------TPSATSLPQ--- 189

  Fly   409 GTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRV 473
             |:::|.           |:......||.::..||:..|.:||:.:|:|.|||||||:..||.||
  Rat   190 -TMVMTS-----------PVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKCLENRV 242

  Fly   474 EILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKHNV 513
            .:              ||..|..|:.:|..|:.|.|..:|
  Rat   243 AV--------------LENQNKTLIEELKTLKDLYSHKSV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 17/49 (35%)
coiled coil 452..495 CDD:269837 15/42 (36%)
Atf1NP_001094365.1 pKID 47..81 CDD:396650 9/33 (27%)
bZIP_CREB1 212..266 CDD:269838 25/67 (37%)
coiled coil 213..264 CDD:269838 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.