DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Creb3l3

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001012115.1 Gene:Creb3l3 / 314638 RGDID:1308152 Length:470 Species:Rattus norvegicus


Alignment Length:227 Identity:80/227 - (35%)
Similarity:109/227 - (48%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 SNSSDKSHAHGYGIPLTPPSSLPSDDSEGNLSPEHL---FAPLSPNATVSISVANPAGGESSVRV 362
            |:|.|.....|.|.........||...||. .|.:|   ..|..|...|.         ||||.:
  Rat    96 SDSQDTPPGSGPGSANVAARCHPSKQGEGP-CPSYLPSTACPEPPRTQVH---------ESSVAI 150

  Fly   363 S----RTAASITRSSSGSASASGSSTSSTVTT------TRQPIHTPLISSQPKGSTGTLLLTEEE 417
            .    .|........:||.|....:....:.:      .:.|:....:.....|....|:|||:|
  Rat   151 DLDMWSTDTLYPEEQAGSPSRFNLTVKELLLSGGGGDLQQHPLAASQLLGPGSGHCQELVLTEDE 215

  Fly   418 KRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHD 482
            |:.|..||..:|.:|||||.||:.||||||||:||.||||||:|||||:|.||.|:.....:|.:
  Rat   216 KKLLAKEGVTLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLENRMSACTAQNQE 280

  Fly   483 YKKRLEGLEETNANLLSQLHKLQALVSKHNVK 514
            .::::..||:.|.:||.||..|||||.:...|
  Rat   281 LQRKVLHLEKQNLSLLEQLKHLQALVVQSTSK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 23/49 (47%)
coiled coil 452..495 CDD:269837 19/42 (45%)
Creb3l3NP_001012115.1 PHA03185 <40..139 CDD:177553 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..145 14/58 (24%)
bZIP_CREB3 240..300 CDD:269837 32/59 (54%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 241..270 23/28 (82%)
coiled coil 242..293 CDD:269837 26/50 (52%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 281..302 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338133
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44712
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.