DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Creb3

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001382561.1 Gene:Creb3 / 298400 RGDID:1308831 Length:387 Species:Rattus norvegicus


Alignment Length:227 Identity:76/227 - (33%)
Similarity:103/227 - (45%) Gaps:63/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LMAKMEIKSEKQSTSNSSDKS--HAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSIS 349
            |::.:...|......|||..|  |.|.|.:|                 .||:...|.|.:.....
  Rat    73 LLSSLLSPSSSPDVLNSSSSSILHDHNYSLP-----------------QEHVSIDLDPGSFEKEG 120

  Fly   350 V-ANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPIHTPLISSQPKGSTGTLLL 413
            . .||      :||..|||                                     :....||:|
  Rat   121 FRMNP------LRVEETAA-------------------------------------EQELSTLIL 142

  Fly   414 TEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVT 478
            ||||||.|..||..:|..|||||.||:.||::||||:||.:|||||:|||.|:..||.||.....
  Rat   143 TEEEKRLLEKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTA 207

  Fly   479 ENHDYKKRLEGLEETNANLLSQLHKLQALVSK 510
            :|.:.:.:::.|||.|.:||.||.||||:|::
  Rat   208 QNQELQNKVQHLEEQNLSLLDQLRKLQAMVTE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 22/49 (45%)
coiled coil 452..495 CDD:269837 18/42 (43%)
Creb3NP_001382561.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 137 1.000 Inparanoid score I4444
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.