DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and crh-2

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_740987.4 Gene:crh-2 / 259434 WormBaseID:WBGene00016162 Length:351 Species:Caenorhabditis elegans


Alignment Length:376 Identity:104/376 - (27%)
Similarity:158/376 - (42%) Gaps:109/376 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SGLQSLQAH----QPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICSDIEI 207
            ||:.:...|    :.:|||.|                   ...|||:||                
 Worm    65 SGIFNQSRHSSTGEDYHGSSS-------------------GSPSSSLSS---------------- 94

  Fly   208 DESAIKDEPMSPD----SSCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNN 268
             .:..||||:..|    :|...:|.|.:::|.|               .|...|::     :.::
 Worm    95 -PNEFKDEPLGLDVHFGNSLFNAPFSPSATSSH---------------SPSSYGMM-----HGSH 138

  Fly   269 SLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPLTPPSSLPSDDSEGNLSP 333
            |:...|..|||:              |...|.::.|...|...:.:.....:||..:.::....|
 Worm   139 SMASHQLHQQQL--------------SPLPSVAHFSHSHHLQHHVVQHPSQASLQMNMNQIFSGP 189

  Fly   334 EHLFAPLSPNATV---SISVANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPI 395
            .|.:|..|...|.   ..::....||                       .|.:.:......|..:
 Worm   190 SHQYASSSVPHTFLFKDSTIYEGMGG-----------------------MGLAAAQQQLKARNKM 231

  Fly   396 H-----TPLISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISA 455
            |     ..||:.|...:.|.|:|:.||:|||:.|||.||||.||||:||:|||.:|||||||:||
 Worm   232 HEMAIRQHLITDQNITANGDLVLSAEERRTLVQEGYSIPQKYPLTKSEEESLKIVRRKIKNKLSA 296

  Fly   456 QESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQA 506
            ||||||:|||:|.||.|:.....||...||::..||.:|.:|..:||:.::
 Worm   297 QESRRKRKEYIDALEGRLHCFSEENKSLKKQVHQLEASNRDLQQKLHQYES 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 24/49 (49%)
coiled coil 452..495 CDD:269837 22/42 (52%)
crh-2NP_740987.4 bZIP_CREB3 283..343 CDD:269837 32/59 (54%)
coiled coil 285..336 CDD:269837 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6331
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003444
OrthoInspector 1 1.000 - - oto20008
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46004
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3645
SonicParanoid 1 1.000 - - X2341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.130

Return to query results.
Submit another query.