DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Crem

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001104330.1 Gene:Crem / 25620 RGDID:2402 Length:357 Species:Rattus norvegicus


Alignment Length:402 Identity:82/402 - (20%)
Similarity:158/402 - (39%) Gaps:88/402 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ISRLSSNPALNTSVADLTRSSGLQSLQAHQPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSS 191
            :|:......:.|:|..:|    ::::::.|..   ..:|.|.   ||              |.:.
  Rat     1 MSKCGRKKYMRTNVRQMT----METVESQQDR---SVTHSVA---EH--------------SSAH 41

  Fly   192 LRDGSMSPDICSDIEIDESAI-KDEPMSPDSSCPASPTSQAS---SSQHQLSLNLAHLQSEMLFE 252
            ::.|.:|....:.:.:..|.. :..|.......|:..|.|..   .:.|...:....:|:..:  
  Rat    42 MQTGQISVPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQIQTVQV-- 104

  Fly   253 PKHCGLLLTASSNSNNSLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSN-SSDKSHAHGYGIPL 316
                ..:.....::::.:|.|.:|::.:..:.:......|:.|:...... ..:||...|     
  Rat   105 ----ATIAETDDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEG----- 160

  Fly   317 TPPS----SLPS---DDSEGNLSPEHLFAPLSPNATVSISVANPAGGESSVRVSRTAASITRSSS 374
            |||:    ::|:   ..|.|.      :..::...|:.||  ||  |...|   :...::|.::|
  Rat   161 TPPNIATMAVPTSIYQTSTGQ------YIAIAQGGTIQIS--NP--GSDGV---QGLQALTMTNS 212

  Fly   375 GS----------ASASGSSTSSTVTTTRQPI----HTPLISSQPKGSTGTLLLTE-EEKRTLLAE 424
            |:          |:.|...|........|.:    .|.|..|....:||.:...: ....|.|.:
  Rat   213 GAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQ 277

  Fly   425 GYPI---------PQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTEN 480
            |..:         ||:|    |||.:.|:..|.:||:.:|:|.|||||||:..||.||.:|..:|
  Rat   278 GVVMAASPGSLHSPQQL----AEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQN 338

  Fly   481 HDYKKRLEGLEE 492
            ....:.|:.|::
  Rat   339 KTLIEELKALKD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 17/41 (41%)
coiled coil 452..495 CDD:269837 17/41 (41%)
CremNP_001104330.1 pKID 112..151 CDD:396650 5/38 (13%)
bZIP_CREB1 301..355 CDD:269838 21/50 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.