DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and ATF6

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_011507610.1 Gene:ATF6 / 22926 HGNCID:791 Length:689 Species:Homo sapiens


Alignment Length:453 Identity:106/453 - (23%)
Similarity:170/453 - (37%) Gaps:139/453 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VPPTHATPIS-----RLSS--NPALNTSVADLTRSSGLQSLQAHQPHHGSGSSHVVVANLEHFQL 176
            |..|..:|.|     ||..  :.||...:...|.:..||...|::.:..:      ..||:    
Human     7 VAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENN------FDNLD---- 61

  Fly   177 PQHLYDNDCSSSVSSLRDGSMSPDICSDIEIDESAIKDEPMSPDSS--CPASPTSQASSSQHQLS 239
                :|.|.....|.:.|  ::..||:   :.:...:.:|:||.||  ..:||.|..|.|..|  
Human    62 ----FDLDLMPWESDIWD--INNQICT---VKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQ-- 115

  Fly   240 LNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQD-NLLMAKMEIKSEKQSTS-- 301
                |:..|           |..||:       ||.....:.|:: |.|.:...:|.:|..|.  
Human   116 ----HVPEE-----------LDLSSS-------SQMSPLSLYGENSNSLSSAEPLKEDKPVTGPR 158

  Fly   302 NSSDKSHAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSISVANPAGGESSVRVSRTA 366
            |.::..        |||...: ..:|:.::.|:.|..|.:|....:.||  ||         :|.
Human   159 NKTENG--------LTPKKKI-QVNSKPSIQPKPLLLPAAPKTQTNSSV--PA---------KTI 203

  Fly   367 ASITRSSSGSASASGSSTSSTVTTTRQPI--HTPLISSQPKGSTG-TLLLTEEEKRTLLAEGY-- 426
            ...|                  ..|..|:  ..|:||.||..:.| |:||::.....|.|.|.  
Human   204 IIQT------------------VPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLP 250

  Fly   427 ------------------------------PIPQKLPLTKAEEKS-----------LKKIRRKIK 450
                                          |:..||.:||...:|           |::.:|.||
Human   251 SAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQRMIK 315

  Fly   451 NKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKHNV 513
            |:.||.:||:||||||..||.|::..::||...||....|:.....::|:..:|:....|..|
Human   316 NRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLDEVVSENQRLKVPSPKRRV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 19/49 (39%)
coiled coil 452..495 CDD:269837 18/42 (43%)
ATF6XP_011507610.1 bZIP_ATF6 309..360 CDD:269848 22/50 (44%)
coiled coil 309..360 CDD:269848 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.