DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and CREB3L4

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001242907.1 Gene:CREB3L4 / 148327 HGNCID:18854 Length:395 Species:Homo sapiens


Alignment Length:415 Identity:109/415 - (26%)
Similarity:158/415 - (38%) Gaps:167/415 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LTFHVPPTHATPISRLSSNPALNTSVADLTRSSGLQ----------SLQAHQPHHGSGSSHVVVA 169
            |..|.||.. .|::||              :..|||          .||..:|..          
Human    28 LGLHCPPPE-VPVTRL--------------QEQGLQGWKSGGDRGCGLQESEPED---------- 67

  Fly   170 NLEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICSDIEIDESAIKDEPMSPDSSCPASPTSQASSS 234
            .|:.|..|..:|   ||.:         ||.       .:|.|.::|..|||    .|..:|:| 
Human    68 FLKLFIDPNEVY---CSEA---------SPG-------SDSGISEDPCHPDS----PPAPRATS- 108

  Fly   235 QHQLSLNLAHLQSEMLFEPKH-CGLL--LTASSNSNNSLIKSQ--QRQQQILGQDNLLMAKMEIK 294
                        |.||:|..: .|.|  :...:..|..||..|  |.....:..|:.:::::.. 
Human   109 ------------SPMLYEVVYEAGALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPF- 160

  Fly   295 SEKQSTSNSSDKSHAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSISVANPAGGESS 359
                       .:|||          .||   ..|.::|    .|.                   
Human   161 -----------DAHAH----------ILP---RAGTVAP----VPC------------------- 178

  Fly   360 VRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPIHTPLISSQPKGSTGTLLLTEEEKRTLLAE 424
                                                 |.|:..|      ||.||:||||.|..|
Human   179 -------------------------------------TTLLPCQ------TLFLTDEEKRLLGQE 200

  Fly   425 GYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEG 489
            |..:|..||||||||:.|||:||||:||.|||:|||:||||:|.||.||.....:|.:.:|:::.
Human   201 GVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQKKVQE 265

  Fly   490 LEETNANLLSQLHKLQALVSKHNVK 514
            ||..|.:|::||.:||.|:::.:.|
Human   266 LERHNISLVAQLRQLQTLIAQTSNK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 23/49 (47%)
coiled coil 452..495 CDD:269837 20/42 (48%)
CREB3L4NP_001242907.1 PCC 77..>154 CDD:188093 26/112 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..108 10/45 (22%)
bZIP_CREB3 218..278 CDD:269837 31/59 (53%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 219..248 21/28 (75%)
coiled coil 220..271 CDD:269837 26/50 (52%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 259..280 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144422
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40574
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.