DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and CREM

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_024303592.1 Gene:CREM / 1390 HGNCID:2352 Length:360 Species:Homo sapiens


Alignment Length:373 Identity:83/373 - (22%)
Similarity:146/373 - (39%) Gaps:88/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SVSSLRDGSMSPDICSDIEIDESAIKDEPMSPDSSCPA-SPTSQASSSQHQLS--LNLAHL---- 245
            :|.|..|||::..:     .:..:...:..:..:|.|| :..|.|.|...:.|  :.|..|    
Human    21 TVESQHDGSITASL-----TESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQ 80

  Fly   246 ----------------QSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQDNLLMAKMEIK 294
                            ||..:...:...:..|..|..:..:|.|.:|::.:..:.:......|:.
Human    81 TIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS 145

  Fly   295 SEKQSTSN-SSDKSHAHGYGIPLTPPS----SLPS---DDSEGNLSPEHLFAPLSPNATVSISVA 351
            |:...... ..::|...|     ||||    ::|:   ..|.|.      :..::...|:.||  
Human   146 SDVPGVPKIEEERSEEEG-----TPPSIATMAVPTSIYQTSTGQ------YIAIAQGGTIQIS-- 197

  Fly   352 NPAGGESSVRVSRTAASITRSSSGS----------ASASGSSTSSTVTTTRQPI----HTPLISS 402
            ||  |...|   :...::|.::||:          |:.|...|........|.:    .|.|..|
Human   198 NP--GSDGV---QGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPS 257

  Fly   403 QPKGSTGTLLLTEEEKRT-LLAEGYPI---------PQKLPLTKAEEKSLKKIRRKIKNKISAQE 457
            ....:||.:...:....| .|.:|..:         ||:|    |||.:.|:..|.:||:.:|:|
Human   258 HMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQL----AEEATRKRELRLMKNREAARE 318

  Fly   458 SRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQ 505
            .|||||||:..||.||.:|..:|....:.|:.|::.      ..||::
Human   319 CRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDL------YCHKVE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 17/49 (35%)
coiled coil 452..495 CDD:269837 17/42 (40%)
CREMXP_024303592.1 pKID 117..154 CDD:308015 5/36 (14%)
bZIP_CREB1 304..358 CDD:269838 21/59 (36%)
coiled coil 305..357 CDD:269838 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.