DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and ATF6B

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_004372.3 Gene:ATF6B / 1388 HGNCID:2349 Length:703 Species:Homo sapiens


Alignment Length:497 Identity:112/497 - (22%)
Similarity:176/497 - (35%) Gaps:153/497 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DVKDPTVILNDKLIS--------DALLNGTQPIKTEHSYSLSSDVDSLPDSPKSLQAKIEDMDDE 93
            ::.|||....|.|:|        ..|.:|...:..|.:.........:|....||...::     
Human     9 EIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMD----- 68

  Fly    94 CFPAISPKTATNGRVTIDPKYLTFHVPPTHATPI---SRLSSNPALNTSVADLTRSSGLQSLQAH 155
                :||..                 ||....||   .::.|.|:...|.:.|:..|...|.:..
Human    69 ----VSPSE-----------------PPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS 112

  Fly   156 QPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSSLRDGSM-SPDICSDIEIDESAIKDEPMSP 219
            ....|.|  .|:....|....|..|..:|.:||..:::...: :.|..||::     .|.||:||
Human   113 SEALGVG--EVLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQ-----TKIEPVSP 170

  Fly   220 DSSCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQD 284
            .||.                                         ||..||:.:....|..:|::
Human   171 CSSV-----------------------------------------NSEASLLSADSSSQAFIGEE 194

  Fly   285 NLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPL--TPPSSL--------PS-DDSEGNLSPEHLFA 338
            .|     |:|:|..|.|           |..|  .|..||        || |.|.|...|... .
Human   195 VL-----EVKTESLSPS-----------GCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTRK-P 242

  Fly   339 PLSPNATVSISVANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPIHTPL---- 399
            ||.|...|..:|..|                      |.:...|:|....:..:.|..:|:    
Human   243 PLQPKPVVLTTVPMP----------------------SRAVPPSTTVLLQSLVQPPPVSPVVLIQ 285

  Fly   400 --ISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKK 462
              |..||:|...:  |...|:::::..  |:|......:.:.|.||:.:|.|||:.||.:|||||
Human   286 GAIRVQPEGPAPS--LPRPERKSIVPA--PMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKK 346

  Fly   463 KEYMDQLERRVEILVTENHD-------YKKRLEGLEETNANL 497
            |||:..||.|::.::.:|..       .::|||.|...|:.|
Human   347 KEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSEL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 20/53 (38%)
coiled coil 452..495 CDD:269837 18/49 (37%)
ATF6BNP_004372.3 Transcription activation 2..86 18/102 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..114 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..248 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..317 5/27 (19%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 327..347 11/19 (58%)
bZIP_ATF6 328..379 CDD:269848 19/50 (38%)
coiled coil 328..379 CDD:269848 19/50 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 350..357 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..565
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.