DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and Atf6b

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_059102.2 Gene:Atf6b / 12915 MGIID:105121 Length:706 Species:Mus musculus


Alignment Length:494 Identity:117/494 - (23%)
Similarity:178/494 - (36%) Gaps:150/494 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DVKDPTVILNDKLIS-----DALLNGTQPIKTEHSYSLSSDVDSLPDSPKSLQAKIEDMDDECFP 96
            ::.|||....|.|:|     ..|.:|...:..|.:.........:|....||...::        
Mouse    16 EIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQAQLFRCVEQDVPFDSSSLDVGMD-------- 72

  Fly    97 AISPKTATNGRVTIDPKYLTFHVPPTHATPI---SRLSSNPALNTSVADLTRSSGLQSLQAHQPH 158
             :||           |:      ||....||   .::.|.|:...|.:.|  ||....|....|.
Mouse    73 -VSP-----------PE------PPWDPLPIFPDLQVKSEPSSPCSSSSL--SSESSHLSTEPPS 117

  Fly   159 HGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSSLR--DGSMSPDICSDIEIDESAIKDEPMSPDS 221
            ...|...|:...:|....|..|..:|.:|...:::  .||.|.|: |||:     .|.||.||  
Mouse   118 QVPGVGEVLHVKMESLAPPLCLLGDDPASPFETVQITVGSASDDL-SDIQ-----TKLEPASP-- 174

  Fly   222 SCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQDNL 286
                      |||.|                             |..||:.:....|..:|::.|
Mouse   175 ----------SSSVH-----------------------------SEASLLSADSPSQPFIGEEVL 200

  Fly   287 LMAKMEIKSEKQSTSNSSDKSHAHGYGIPL--TPPSSL--------PSDDSEGNLSPEHLFAPLS 341
                 |:|:|..|..           |..|  .|.|||        ||.||....:|.....||.
Mouse   201 -----EVKTESPSPP-----------GCLLWDVPASSLGAVQISMGPSPDSSSGKAPATRKPPLQ 249

  Fly   342 PNATVSISVANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPIHTPL------I 400
            |...|..:|..|.      |...|:|::...                ...:||..:|:      |
Mouse   250 PKPVVLTTVPVPP------RAGPTSAAVLLQ----------------PLVQQPAVSPVVLIQGAI 292

  Fly   401 SSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEY 465
            ..||:|....  ....|:::::..  |:|......:.:.|.||:.:|.|||:.||.:||||||||
Mouse   293 RVQPEGPAPA--APRPERKSIVPA--PMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEY 353

  Fly   466 MDQLERRVEILVTENHD-------YKKRLEGLEETNANL 497
            :..||.|::.::.:|..       .::|||.|...|:.|
Mouse   354 LQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSGL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 20/53 (38%)
coiled coil 452..495 CDD:269837 18/49 (37%)
Atf6bNP_059102.2 bZIP_ATF6 332..383 CDD:269848 19/50 (38%)
coiled coil 332..383 CDD:269848 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.