DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and CREB3

DIOPT Version :10

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_006359.3 Gene:CREB3 / 10488 HGNCID:2347 Length:371 Species:Homo sapiens


Alignment Length:202 Identity:80/202 - (39%)
Similarity:112/202 - (55%) Gaps:19/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 PPSSLPSDDSEGNLSPEHLFAPLSPNATVSI-SVANP--AGGESSVRVSRTAASITRSSSGSASA 379
            |.|.:|||....:|    |.:.|||.|:::| |.:||  ...:.:..:.|...|:...|. |...
Human    40 PLSEVPSDWEVDDL----LCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESE-SCRK 99

  Fly   380 SGSSTSSTVTTTRQPIHTPLISSQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKK 444
            .|        |...|.|...::.|   ....|:||:|||..|..||..:|:.|||||.||:.||:
Human   100 EG--------TQMTPQHMEELAEQ---EIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKR 153

  Fly   445 IRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVS 509
            :||||:||.||||||||||.|:..||.||.....:|.:.:.:::.|||.|.:||.||.||||:|.
Human   154 VRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVI 218

  Fly   510 KHNVKKS 516
            :.:.|.|
Human   219 EISNKTS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 24/49 (49%)
coiled coil 452..495 CDD:269837 20/42 (48%)
CREB3NP_006359.3 Transcription activation (acidic). /evidence=ECO:0000269|PubMed:10984507 1..92 17/55 (31%)
LXXLL motif 1 13..17
LXXLL motif 2 54..58 1/3 (33%)
HCFC1-binding-motif (HBM) 78..81 0/2 (0%)
bZIP_CREB3 151..211 CDD:269837 31/59 (53%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 152..184 22/31 (71%)
coiled coil 153..204 CDD:269837 25/50 (50%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 192..213 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.