DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and creb3l3b

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_009297197.2 Gene:creb3l3b / 100538072 ZFINID:ZDB-GENE-131023-1 Length:388 Species:Danio rerio


Alignment Length:419 Identity:109/419 - (26%)
Similarity:160/419 - (38%) Gaps:151/419 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 MDDECFPAISPKTATNGRVTIDPKYLTFHVPPTHATPISRLSSNPALNTSVADLTRSSGLQSLQA 154
            :.|:|||.              |:.|...:.|......:|.:.:.:...|:||       ||:..
Zfish     4 LSDKCFPG--------------PELLELLLEPHRVPDTARDAKHGSPAWSMAD-------QSIAC 47

  Fly   155 HQPHHGSGSSHVVVANLEHFQLPQHLYDNDCSSSVSSLRDGSMSPDICSDIEIDESAIKDEPMSP 219
            |:            ..::.|              :.||.|.|.....|      :|.|.|:  ||
Zfish    48 HE------------GVMDDF--------------LDSLLDMSKPCSPC------DSGISDD--SP 78

  Fly   220 DSSCPASPTSQASSSQHQLSLNLAHLQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQD 284
             |.|..||...|||:          ..|..|.:|                               
Zfish    79 -SECLDSPPPSASSA----------FSSVFLHQP------------------------------- 101

  Fly   285 NLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSIS 349
                      ..:|.|:...|      :.|.|.        |.|..|..:.|..|..|:|.|.  
Zfish   102 ----------LPQQDTNTEPD------FSIDLA--------DWEACLFSDSLTDPQFPSAVVK-- 140

  Fly   350 VANPAGGESSVRVSRTAASITRSSSGSASASGSSTSSTVTTTRQPIHTPLISSQPKGSTGTLLLT 414
             :.|             |::.:.:......|.::..||..:|:|..|              |:|.
Zfish   141 -SQP-------------AAVYQLTVKDLLLSSTAEPSTKPSTQQSQH--------------LILN 177

  Fly   415 EEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTE 479
            ::||:.|..||..:|.:|||.|.|||.||||||||:||.||||||:|||||:|.||.|:......
Zfish   178 DDEKKLLAKEGVSLPSQLPLNKYEEKVLKKIRRKIRNKQSAQESRKKKKEYIDGLEGRMAACSAH 242

  Fly   480 NHDYKKRLEGLEETNANLLSQLHKLQALV 508
            |.|.::::..||:||.:|:.||.:||||:
Zfish   243 NLDLQRKVLQLEKTNTSLMEQLRRLQALL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 24/49 (49%)
coiled coil 452..495 CDD:269837 21/42 (50%)
creb3l3bXP_009297197.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0709
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24914
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.