DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and creb3l4

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_021322460.1 Gene:creb3l4 / 100333318 ZFINID:ZDB-GENE-030131-403 Length:412 Species:Danio rerio


Alignment Length:304 Identity:85/304 - (27%)
Similarity:127/304 - (41%) Gaps:86/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 ASSNSNNSLIKSQQRQQQILGQD--NLLMAKMEIKSEKQSTSNSSDKSHAHGYGIPLTPPSSLPS 324
            |.|...:..::.....:.:|.|.  .||.|.:|..:|..|                |.|..||  
Zfish    11 AKSTERDGFVEEVVASELLLDQSCPGLLFADLEKHTEDWS----------------LQPHCSL-- 57

  Fly   325 DDSEGNLSPEHLFAPLSPNATVSISVANPAGGESSVRVSRTAASITRSSS--------------- 374
            :|||.    |.:...::||.....:|.....|.|..:.|..|...|.||:               
Zfish    58 NDSES----EEVLNAINPNQMYVSAVCESDSGVSEDQSSDGAHEHTSSSASQLPVYQVVYDISGV 118

  Fly   375 GSASASGSSTSSTVTTTRQPIHTPLISSQPKGSTGTLLLTE-------------EEKRTL----L 422
            |.|||.           ..|.|..:||.|....:..:||:|             |:...|    |
Zfish   119 GGASAE-----------PHPPHVDVISIQLDEWSSQMLLSESCVVNELLSPVKTEDVSALDMQSL 172

  Fly   423 AE--GYPIPQKL-PLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYK 484
            .|  |:.:..|: .:::|||:.|||:||||:||:|||:|||:||||:|.||.|  ...|.:|.:.
Zfish   173 QEDDGFLVCVKICRISQAEERILKKVRRKIRNKLSAQDSRRRKKEYIDGLESR--YTHTSDHSHT 235

  Fly   485 KRL--------------EGLEETNANLLSQLHKLQALVSKHNVK 514
            ..:              ..|.:.|.:|::|||:||||:.:...|
Zfish   236 PLIIHTQYRRVHRSDLGSRLGQQNWSLVAQLHRLQALIKQTATK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 21/63 (33%)
coiled coil 452..495 CDD:269837 18/56 (32%)
creb3l4XP_021322460.1 bZIP_CREB3 195..267 CDD:269837 29/73 (40%)
coiled coil 197..260 CDD:269837 24/64 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.