DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and creb3l2

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001120351.1 Gene:creb3l2 / 100145418 XenbaseID:XB-GENE-996211 Length:271 Species:Xenopus tropicalis


Alignment Length:423 Identity:92/423 - (21%)
Similarity:125/423 - (29%) Gaps:179/423 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEFYD-GDLKDIWDSDLDPESLKISPDHDMHDWLFDRDVKDPTV------ILNDKLISDAL---- 54
            ||..: ||....||..|...|.....|...::..|...:.|..:      ::.|..:::..    
 Frog     1 MEIMESGDPVIQWDRKLSELSEAAESDSLYNNTPFSELIDDSALLDVLGQLMGDPFLTEKYEMME 65

  Fly    55 --LNGTQP---IKTEHSYSLSSDVDSLPDSPKSLQAKIEDMDDECFPAISPKTATNGRVTIDPKY 114
              :|.:.|   ||.||||||..  ||.|.||.                                 
 Frog    66 VEMNPSSPSPMIKAEHSYSLCG--DSRPQSPF--------------------------------- 95

  Fly   115 LTFHVPPTHATPISRLSSNPALNTSVADLTRSSGLQSLQAHQPHHGSGSSHVVVANLEHFQLPQH 179
                   |||      ||:.  |.|.||||.                                  
 Frog    96 -------THA------SSDD--NFSDADLTG---------------------------------- 111

  Fly   180 LYDNDCSSSVSSLRDGSMSPDICSDIEIDESAIKDEPMSPDSSCPASPTSQASSSQHQLSLNLAH 244
              |:.|.:  ..|...|.:..|..:|.:||:    ..:.|..|..|:..|               
 Frog   112 --DDWCLN--GELTATSPASKIKVEIPLDET----PGLVPSVSLAANAVS--------------- 153

  Fly   245 LQSEMLFEPKHCGLLLTASSNSNNSLIKSQQRQQQILGQDNLLMAKMEIKSEKQSTSNSSDKSHA 309
                             ||..::|........|.:||...:|...|:| ..|.....|...|..|
 Frog   154 -----------------ASPEADNPSEMPVPEQGKILSPVSLPQIKLE-PHEVDQFLNLCPKEAA 200

  Fly   310 --HGYGIPLTPPSSLPSDDSEGNLSPEHLFAPLSPNATVSISVANPAGGESSVRVSRTAASITRS 372
              ....:|.|||||..| ||||..||.....|.||       |.:.|||:...|           
 Frog   201 TTEALQMPPTPPSSHGS-DSEGGQSPTRSLPPPSP-------VQSQAGGKMPAR----------- 246

  Fly   373 SSGSASASGSSTSSTVTTTRQPIHTPLISSQPK 405
               |.||..:|              ||:::.||
 Frog   247 ---SPSALSNS--------------PLLTAPPK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837
coiled coil 452..495 CDD:269837
creb3l2NP_001120351.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.