DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebA and creb3

DIOPT Version :9

Sequence 1:NP_524087.3 Gene:CrebA / 39682 FlyBaseID:FBgn0004396 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_031760389.1 Gene:creb3 / 100127204 XenbaseID:XB-GENE-959045 Length:461 Species:Xenopus tropicalis


Alignment Length:113 Identity:61/113 - (53%)
Similarity:81/113 - (71%) Gaps:1/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 SQPKGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYM 466
            :|.:|..| |.|||||.|.|..||..:||.||||||||::||::||||:||.||||||:|||||:
 Frog   177 TQYQGQPG-LRLTEEESRLLGKEGIILPQHLPLTKAEERALKRVRRKIRNKRSAQESRKKKKEYV 240

  Fly   467 DQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKHNVK 514
            |.||.||....|:|...:.:::.|::.|.:||.||..||||:.:..||
 Frog   241 DGLESRVTACTTQNQVLQNQVQQLQKQNRSLLQQLRNLQALLRQTGVK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebANP_524087.3 bZIP_CREB3 452..502 CDD:269837 24/49 (49%)
coiled coil 452..495 CDD:269837 20/42 (48%)
creb3XP_031760389.1 bZIP_CREB3 216..276 CDD:269837 31/59 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D288251at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.