DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG42397

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:152 Identity:40/152 - (26%)
Similarity:60/152 - (39%) Gaps:23/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 EEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCTNYYLCYHGHA 160
            |:..|..|  ..|...||..|||.:..:.|.|.  |...|     :|:.:.: |..||.|.:|..
  Fly    25 EDTNIKLT--TDESTTVEDTTEVLVTTLPPPVL--CADED-----LFLPAPD-CREYYQCLYGEG 79

  Fly   161 MEMHCDNELYFNSLTGQCDYPDKVQCAFE-----DPRSHKC---LPHMTEFFPHPDNCNYFYYCI 217
            :...|.:.||::.....|.: |...||.:     .|.:..|   ||    |.|:..:|..|..|:
  Fly    80 ILKICPDGLYWDRELNVCAW-DSQHCADDKNETTTPSTLNCASGLP----FLPYIPDCTKFIQCV 139

  Fly   218 KGFLTLQQCPFYYGWDIERRSC 239
            ........||....|:...:||
  Fly   140 YNIGFKLSCPSGLYWNQPLQSC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884
CBM_14 142..184 CDD:279884 11/41 (27%)
ChtBD2 203..240 CDD:214696 10/37 (27%)
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 12/50 (24%)
ChtBD2 125..163 CDD:214696 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.