DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and Mur89F

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262662.1 Gene:Mur89F / 42080 FlyBaseID:FBgn0038492 Length:2159 Species:Drosophila melanogaster


Alignment Length:313 Identity:68/313 - (21%)
Similarity:99/313 - (31%) Gaps:104/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WESCQSYVYCEGEESLKGDCEDGEY----FDSEAGTCDIAA-------------NVSCFLDEVDE 85
            |::  |...|...:.:.|:|..|:.    ..:|.||.:...             |.:.:..|...
  Fly  1847 WDT--STETCNYADQVSGNCSSGQTTTPGTTTEPGTTESTTSSGKPETTSKAPENTTTWAPETTT 1909

  Fly    86 PSDPEPETDEEEE--------EIPATPR-PTEPPIVET-------------PTEVDIINIAPVVR 128
            .|.||..|....|        ...|||. .|:||..||             ||..:  :.||...
  Fly  1910 TSSPETTTTVASETTTTTSGTTTTATPETTTKPPKPETTTIAGEETSTSKSPTTTE--SPAPSTN 1972

  Fly   129 PNCPISD-DPGQVIFMASN------NSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCD----YPD 182
            .:.|..: .|||.:::...      ..|..:|.|     .|...:|:|  |.:..||.    |.|
  Fly  1973 TSAPCPETGPGQNVYVCPTGFRRHPEKCGMFYQC-----SESADNNDL--NIVVFQCPNGTVYQD 2030

  Fly   183 KVQCAFEDPRSHKC-----------------------------LPHMTEFFPHPDNC-NYFYYCI 217
            |.....:.|...||                             .|....|..:.|.| ..|..| 
  Fly  2031 KSCSCGKPPAGDKCSKDMKRTTNAFEEETKLQNVVQISTTDPLCPDEGHFALNNDQCGQLFVKC- 2094

  Fly   218 KGF--LT------LQQCP--FYYGWDIERRSCVQIGVAKCYGNSRRIGRKAPL 260
             ||  ||      :.:||  |.| |::.||......:..|...:..:|...||
  Fly  2095 -GFSELTGRIEGQIHRCPQGFAY-WNVSRRCEPARKLPNCTPTTYNVGGNVPL 2145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 10/55 (18%)
CBM_14 142..184 CDD:279884 11/51 (22%)
ChtBD2 203..240 CDD:214696 16/47 (34%)
Mur89FNP_001262662.1 CBM_14 57..106 CDD:279884
CBM_14 200..250 CDD:279884
CBM_14 484..536 CDD:279884
CBM_14 745..798 CDD:279884
CBM_14 1025..1074 CDD:279884
CBM_14 1206..1261 CDD:279884
CBM_14 1336..1388 CDD:279884
CBM_14 1523..1577 CDD:279884
VAD1-2 <1599..>1656 CDD:291956
CBM_14 1809..1861 CDD:279884 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.