DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG17147

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:240 Identity:51/240 - (21%)
Similarity:77/240 - (32%) Gaps:65/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVSCFLDEVDEPSD 88
            :.|:|: ||.:|.....|..|.||.....|.|.|..|::||..:.:|....:..|          
  Fly    89 NRCEGL-DGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSCLYGVDSMC---------- 142

  Fly    89 PEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCTNYY 153
                                         ||:.||..:|..|....::          ..|..||
  Fly   143 -----------------------------VDVNNICELVAENTKFRNE----------KDCAYYY 168

  Fly   154 LC-YHGHAMEMHC----DNELYFNSLTGQCDYPDKVQCAFEDPRSHKCLPHMTEFFPHPD-NCNY 212
            .| ..|:.....|    ....||:..:|.|...:||:|.... :.:.|....|..|.... .|..
  Fly   169 ECDKTGNHASKSCTVTSKKREYFDVESGNCVEANKVECTAHS-KENVCTSSTTMTFKSDQATCRG 232

  Fly   213 FYYCIKGFLTL-------QQCPFYYGWDIERRSCVQIGVAKCYGN 250
            ::.| |....:       .|||..|.:|.:|:.|.......|..|
  Fly   233 YFVC-KALYPVADLDPLWTQCPEGYFFDEDRQLCANPTTVVCTHN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/50 (32%)
CBM_14 142..184 CDD:279884 10/46 (22%)
ChtBD2 203..240 CDD:214696 10/44 (23%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696
ChtBD2 89..136 CDD:214696 16/47 (34%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.