DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG17145

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:278 Identity:56/278 - (20%)
Similarity:84/278 - (30%) Gaps:88/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKY--LIHLCLVLLWSSR--INADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDG- 60
            |.|:  ::.:.||||....  :|..:.|.|....:...::..|||...:.|....|....|... 
  Fly     1 MEKFGAILGVALVLLLQGLDVVNGRNEDICRLFSNNTVIRDPESCSQSITCIDSVSYYSTCTGST 65

  Fly    61 EYFDSEAGTCDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAP 125
            .:||.:.|.|..:.:.|                                                
  Fly    66 PFFDKDTGKCVKSLSTS------------------------------------------------ 82

  Fly   126 VVRPNCPISDDPGQVIFMASNNSCTNYYLCYHGH-AMEMHCDNELYFNSLTGQCDYPDKVQCAFE 189
              ..:|.||.......|:|...||..||.|.... |:...|..|.:||:.|..|.          
  Fly    83 --TSSCSISCADRAKQFVADPKSCYGYYYCADEETALYGTCPQETHFNATTQMCS---------- 135

  Fly   190 DPRSHK--CLPHMTEF---------FPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCVQIG 243
              |.|:  |.....|:         |.:...||.::.|.||.|..:.|...| :......||...
  Fly   136 --RQHESDCTTSTFEYCSIVKNGVNFDNLQGCNMYHVCEKGVLKDKTCSKTY-YQASTGECVSKA 197

  Fly   244 VAKCYGNSRRIGRKAPLP 261
            :..|..:        |||
  Fly   198 LVDCDAH--------PLP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 11/51 (22%)
CBM_14 142..184 CDD:279884 14/42 (33%)
ChtBD2 203..240 CDD:214696 9/45 (20%)
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 16/62 (26%)
CBM_14 278..327 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.