DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG7017

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster


Alignment Length:243 Identity:53/243 - (21%)
Similarity:89/243 - (36%) Gaps:54/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CDGM-DDGAFVQSWESCQSYVYCEGEESL--KGDCEDGEYFDSEAGTCDIAANVSCFLDEVDEPS 87
            ||.: .:.:|::. .:|.::|.|....|:  :|.|..|..::.|.|.|.:|::.:......|..:
  Fly    33 CDLLPQETSFLRP-NTCDNWVRCASNYSVLEQGGCAAGLNYNKELGRCILASSSAAVCPYADSIA 96

  Fly    88 DPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCTNY 152
            |........|.|                                      |..|...|::.|..|
  Fly    97 DKATNLCANETE--------------------------------------GAFIVDPSSSDCRGY 123

  Fly   153 YLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPR--SHKC--LPHMTEFFPHPDNCNYF 213
            .||.....::.:|.|||.|:.::..|.|..:.:|.....:  |..|  ||:.|. ...|.:|:.:
  Fly   124 ILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTR-LADPVHCDQY 187

  Fly   214 YYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAKCYGNSRRIGRKAPLP 261
            |.|:...|..:.||....:|.....||.:....||       ..|.||
  Fly   188 YECVSEVLHSRACPVASAYDANLGYCVDVAEVSCY-------ESAALP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 14/53 (26%)
CBM_14 142..184 CDD:279884 12/41 (29%)
ChtBD2 203..240 CDD:214696 8/36 (22%)
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 16/89 (18%)
ChtBD2 246..290 CDD:214696
CBM_14 303..348 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.