DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG6996

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:84/251 - (33%) Gaps:63/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVS 77
            |.||.|.....|.|..:..| |.....||..|.||:..:...|.|..|..|:|  ||.|...:..
  Fly    74 LSSSSIKCLSSDPCAALPTG-FAADPYSCNGYYYCKDGKGTHGVCNTGMNFNS--GTQDCIRDFP 135

  Fly    78 CFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIF 142
            |     ....||:                            ...||.|             ..:|
  Fly   136 C-----SNKMDPD----------------------------SYCNILP-------------DGVF 154

  Fly   143 MASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAF---EDPRSHKCLPHMTEFF 204
            :...::|..|.||:.|..:...|....||.:.|.|||||..|:|.|   .|.......|....|.
  Fly   155 VKDTDNCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDISKKGVCPETGGFI 219

  Fly   205 PHPDNCNYFYYCI---KGFLTLQQ--CP---FYYGWD---IERRSCVQIGVAKCYG 249
            .....||.:|||.   .|..:|:.  |.   |:...|   ...||.|:.|..:|.|
  Fly   220 SDNKTCNGYYYCKDLGNGEFSLEHGVCSDGRFFLATDGGACVPRSKVKCGYDRCVG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/50 (32%)
CBM_14 142..184 CDD:279884 15/41 (37%)
ChtBD2 203..240 CDD:214696 13/47 (28%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 16/47 (34%)
CBM_14 146..196 CDD:279884 18/62 (29%)
CBM_14 273..322 CDD:279884 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.