DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG7298

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:314 Identity:59/314 - (18%)
Similarity:101/314 - (32%) Gaps:113/314 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVSCFLDEVDEPSDPE 90
            |..:..|..:.|.||||:|..|:....::..|:.|..:|.:..:|..::.|.|:.. |:.|...:
  Fly    34 CTAVKVGTQLGSIESCQTYYVCQSTGPVQSSCQSGYSYDYKRSSCYPSSEVDCYWG-VENPCAGK 97

  Fly    91 PETDEEEEEIPAT--------------PRPTEPPI---VETPT---------------EVDIINI 123
            ..|     .:|.|              ......|:   .:|.|               |..:.::
  Fly    98 NNT-----WVPNTAVCGGWFYCLEGKSAGSGNCPVNQKFDTTTLACVYGTCSNTQGTNETVLESL 157

  Fly   124 APVVRP---------------------------------------------------------NC 131
            ..||.|                                                         |.
  Fly   158 CDVVPPGQYFGDTESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYESASVCSRVTNI 222

  Fly   132 PISDDPGQVIFMASNNS-------CTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFE 189
            |:||   ..:..::|.:       |..||:|.:|..:..:|....|::...|.|   ...|.|..
  Fly   223 PLSD---AAVSCSTNGAKSADPKVCGTYYVCTNGKNVATYCPTGDYYDDSLGYC---VSRQVATP 281

  Fly   190 DPRSHKCLPHMTEFFPH---PDNCNYFYYC-IKGFLTLQQCPFYYGWDIERRSC 239
            ....::| .:.|..|.:   .:||:.:||| .:|..||..||....:|..|:.|
  Fly   282 VAGCNRC-QYATSTFVNAVDSNNCSTYYYCNSQGEATLNTCPADTFFDESRQGC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 13/50 (26%)
CBM_14 142..184 CDD:279884 10/48 (21%)
ChtBD2 203..240 CDD:214696 14/41 (34%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 9/37 (24%)
ChtBD2 286..334 CDD:214696 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.