DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-H and CG10140

DIOPT Version :9

Sequence 1:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:238 Identity:48/238 - (20%)
Similarity:78/238 - (32%) Gaps:69/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NADHFDECDGMDDGAFVQSWE-SCQSYVYCEGEESLKGDCEDGEYFDSEAGTCDIAANVSCFLDE 82
            :||....|:..:...|  |:: :|..||.|...:.:...|:||..::|....||...||.|    
  Fly   104 DADCLPTCEAFNFSTF--SYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDC---- 162

  Fly    83 VDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNN 147
                                                        |...|.|..:...:.::.|..
  Fly   163 --------------------------------------------VESECSIYSNAYHLRYVPSKV 183

  Fly   148 SCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSHK----------------C 196
            ||..|::|.:|...|..|...|:|::....||.|.|..|  :.|...:                |
  Fly   184 SCQKYFICGNGIPREQTCTAGLHFSTKCDCCDIPSKSDC--QIPAVERKVQQLSRLSPVTTVGIC 246

  Fly   197 LPHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSC 239
            .|....|:.|....:.:|||:.|...:..|.....:|...:.|
  Fly   247 PPSGVHFYVHESRRDAYYYCVDGHGLVLDCSAGLWYDPTVQEC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 14/51 (27%)
CBM_14 142..184 CDD:279884 13/41 (32%)
ChtBD2 203..240 CDD:214696 9/37 (24%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 0/1 (0%)
CBM_14 111..161 CDD:279884 14/51 (27%)
CBM_14 178..222 CDD:279884 14/43 (33%)
CBM_14 246..295 CDD:279884 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.